PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1309_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB_related
Protein Properties Length: 321aa    MW: 35439.3 Da    PI: 7.8373
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1309_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
       RrC1309_p2 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129423.587965IPR017930Myb domain
SuperFamilySSF466892.43E-221197IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002495.5E-161461IPR001005SANT/Myb domain
CDDcd001673.56E-111661No hitNo description
PROSITE profilePS500904.65862101IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.6E-1165106IPR009057Homeodomain-like
SMARTSM007170.2266103IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MVRPPCCDKG GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TGNEENMIVH LQALLGNRTD NDIKNYWNTH LKKKLNKANQ DSNQEVDQSR  120
DHSSLSSSPS SSSANSNSNI ARGQWERRLQ TDINLAKKAL SEALSPAVSP IITLAATTAT  180
TSSSAESRRS ISSARGVLRA QETSTTYASS TENIAKLLKG WVKNSPKTQN SADRMVSPDS  240
VTKEVIKSDV EKDYAGPFQS FSGFDQLKDC DLAGVSHDHE TKPDITGCSN QSQWSLFENW  300
LFEDSGGQIG DILLDESPNF F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-161410527128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667350.0KC966735.1 Brassica napus MYB transcription factor 30 (MYB30.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013677582.10.0PREDICTED: myb-related protein 306-like
RefseqXP_013677581.10.0PREDICTED: myb-related protein 306-like
SwissprotQ9SCU71e-168MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A0A7BWS20.0A0A0A7BWS2_BRANA; MYB transcription factor 30
STRINGBra025361.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-157myb domain protein 30